PrEST Antigen FLOT2 (ATL-APrEST95065)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST95065-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Sequence: VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ
Interspecies mouse/rat: ENSMUSG00000061981: 97%, ENSRNOG00000009681: 97%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ |
| Gene ID - Mouse | ENSMUSG00000061981 |
| Gene ID - Rat | ENSRNOG00000009681 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen FLOT2 (ATL-APrEST95065) | |
| Datasheet | PrEST Antigen FLOT2 (ATL-APrEST95065) Datasheet (External Link) |
| Vendor Page | PrEST Antigen FLOT2 (ATL-APrEST95065) at Atlas Antibodies |
| Documents & Links for PrEST Antigen FLOT2 (ATL-APrEST95065) | |
| Datasheet | PrEST Antigen FLOT2 (ATL-APrEST95065) Datasheet (External Link) |
| Vendor Page | PrEST Antigen FLOT2 (ATL-APrEST95065) |