PrEST Antigen EZH1 (ATL-APrEST94472)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94472-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Sequence: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE |
Gene ID - Mouse | ENSMUSG00000006920 |
Gene ID - Rat | ENSRNOG00000020336 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen EZH1 (ATL-APrEST94472) | |
Datasheet | PrEST Antigen EZH1 (ATL-APrEST94472) Datasheet (External Link) |
Vendor Page | PrEST Antigen EZH1 (ATL-APrEST94472) at Atlas Antibodies |
Documents & Links for PrEST Antigen EZH1 (ATL-APrEST94472) | |
Datasheet | PrEST Antigen EZH1 (ATL-APrEST94472) Datasheet (External Link) |
Vendor Page | PrEST Antigen EZH1 (ATL-APrEST94472) |