PrEST Antigen EVI5L (ATL-APrEST89471)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST89471-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: EVI5L
Alternative Gene Name:
Sequence: PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Interspecies mouse/rat: ENSMUSG00000011832: 91%, ENSRNOG00000001034: 89%
Entrez Gene ID: 115704
Uniprot ID: Q96CN4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
Gene ID - Mouse | ENSMUSG00000011832 |
Gene ID - Rat | ENSRNOG00000001034 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen EVI5L (ATL-APrEST89471) | |
Datasheet | PrEST Antigen EVI5L (ATL-APrEST89471) Datasheet (External Link) |
Vendor Page | PrEST Antigen EVI5L (ATL-APrEST89471) at Atlas Antibodies |
Documents & Links for PrEST Antigen EVI5L (ATL-APrEST89471) | |
Datasheet | PrEST Antigen EVI5L (ATL-APrEST89471) Datasheet (External Link) |
Vendor Page | PrEST Antigen EVI5L (ATL-APrEST89471) |