PrEST Antigen ETS1 (ATL-APrEST90018)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90018-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Sequence: VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
| Gene ID - Mouse | ENSMUSG00000032035 |
| Gene ID - Rat | ENSRNOG00000008941 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ETS1 (ATL-APrEST90018) | |
| Datasheet | PrEST Antigen ETS1 (ATL-APrEST90018) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ETS1 (ATL-APrEST90018) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ETS1 (ATL-APrEST90018) | |
| Datasheet | PrEST Antigen ETS1 (ATL-APrEST90018) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ETS1 (ATL-APrEST90018) |