PrEST Antigen ETS1 (ATL-APrEST90018)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST90018-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Sequence: VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
Gene ID - Mouse | ENSMUSG00000032035 |
Gene ID - Rat | ENSRNOG00000008941 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ETS1 (ATL-APrEST90018) | |
Datasheet | PrEST Antigen ETS1 (ATL-APrEST90018) Datasheet (External Link) |
Vendor Page | PrEST Antigen ETS1 (ATL-APrEST90018) at Atlas Antibodies |
Documents & Links for PrEST Antigen ETS1 (ATL-APrEST90018) | |
Datasheet | PrEST Antigen ETS1 (ATL-APrEST90018) Datasheet (External Link) |
Vendor Page | PrEST Antigen ETS1 (ATL-APrEST90018) |