PrEST Antigen ESAM (ATL-APrEST91300)
Atlas Antibodies
- Catalog No.:
 - ATL-APrEST91300-100
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $345.00
    
         
                            Gene Name: ESAM
Alternative Gene Name: W117m
Sequence: DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
Interspecies mouse/rat: ENSMUSG00000001946: 72%, ENSRNOG00000033217: 72%
Entrez Gene ID: 90952
Uniprot ID: Q96AP7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL | 
| Gene ID - Mouse | ENSMUSG00000001946 | 
| Gene ID - Rat | ENSRNOG00000033217 | 
| Buffer | PBS and 1M Urea, pH 7.4. | 
| Documents & Links for PrEST Antigen ESAM (ATL-APrEST91300) | |
| Datasheet | PrEST Antigen ESAM (ATL-APrEST91300) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen ESAM (ATL-APrEST91300) at Atlas Antibodies | 
| Documents & Links for PrEST Antigen ESAM (ATL-APrEST91300) | |
| Datasheet | PrEST Antigen ESAM (ATL-APrEST91300) Datasheet (External Link) | 
| Vendor Page | PrEST Antigen ESAM (ATL-APrEST91300) |