PrEST Antigen ESAM (ATL-APrEST91300)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91300-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ESAM
Alternative Gene Name: W117m
Sequence: DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
Interspecies mouse/rat: ENSMUSG00000001946: 72%, ENSRNOG00000033217: 72%
Entrez Gene ID: 90952
Uniprot ID: Q96AP7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL |
| Gene ID - Mouse | ENSMUSG00000001946 |
| Gene ID - Rat | ENSRNOG00000033217 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ESAM (ATL-APrEST91300) | |
| Datasheet | PrEST Antigen ESAM (ATL-APrEST91300) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ESAM (ATL-APrEST91300) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ESAM (ATL-APrEST91300) | |
| Datasheet | PrEST Antigen ESAM (ATL-APrEST91300) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ESAM (ATL-APrEST91300) |