PrEST Antigen ERI3 (ATL-APrEST88268)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88268-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ERI3
Alternative Gene Name: FLJ22943, PINT1, PRNPIP
Sequence: QPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
Interspecies mouse/rat: ENSMUSG00000033423: 99%, ENSRNOG00000019381: 99%
Entrez Gene ID: 79033
Uniprot ID: O43414
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | QPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI |
Gene ID - Mouse | ENSMUSG00000033423 |
Gene ID - Rat | ENSRNOG00000019381 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ERI3 (ATL-APrEST88268) | |
Datasheet | PrEST Antigen ERI3 (ATL-APrEST88268) Datasheet (External Link) |
Vendor Page | PrEST Antigen ERI3 (ATL-APrEST88268) at Atlas Antibodies |
Documents & Links for PrEST Antigen ERI3 (ATL-APrEST88268) | |
Datasheet | PrEST Antigen ERI3 (ATL-APrEST88268) Datasheet (External Link) |
Vendor Page | PrEST Antigen ERI3 (ATL-APrEST88268) |