PrEST Antigen EPS15 (ATL-APrEST94213)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94213-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL |
| Gene ID - Mouse | ENSMUSG00000028552 |
| Gene ID - Rat | ENSRNOG00000010299 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen EPS15 (ATL-APrEST94213) | |
| Datasheet | PrEST Antigen EPS15 (ATL-APrEST94213) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EPS15 (ATL-APrEST94213) at Atlas Antibodies |
| Documents & Links for PrEST Antigen EPS15 (ATL-APrEST94213) | |
| Datasheet | PrEST Antigen EPS15 (ATL-APrEST94213) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EPS15 (ATL-APrEST94213) |