PrEST Antigen EMP3 (ATL-APrEST94838)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94838-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: EMP3
Alternative Gene Name: YMP
Sequence: WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW
Interspecies mouse/rat: ENSMUSG00000040212: 89%, ENSRNOG00000021104: 89%
Entrez Gene ID: 2014
Uniprot ID: P54852
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW |
| Gene ID - Mouse | ENSMUSG00000040212 |
| Gene ID - Rat | ENSRNOG00000021104 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen EMP3 (ATL-APrEST94838) | |
| Datasheet | PrEST Antigen EMP3 (ATL-APrEST94838) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EMP3 (ATL-APrEST94838) at Atlas Antibodies |
| Documents & Links for PrEST Antigen EMP3 (ATL-APrEST94838) | |
| Datasheet | PrEST Antigen EMP3 (ATL-APrEST94838) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EMP3 (ATL-APrEST94838) |