PrEST Antigen ELOC (ATL-APrEST93406)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93406-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: ELOC
Alternative Gene Name: SIII
Sequence: ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI |
| Gene ID - Mouse | ENSMUSG00000079658 |
| Gene ID - Rat | ENSRNOG00000031730 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ELOC (ATL-APrEST93406) | |
| Datasheet | PrEST Antigen ELOC (ATL-APrEST93406) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ELOC (ATL-APrEST93406) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ELOC (ATL-APrEST93406) | |
| Datasheet | PrEST Antigen ELOC (ATL-APrEST93406) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ELOC (ATL-APrEST93406) |