PrEST Antigen EFNA5 (ATL-APrEST91499)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91499-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: EFNA5
Alternative Gene Name: AF1, EPLG7, LERK7
Sequence: FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Interspecies mouse/rat: ENSMUSG00000048915: 100%, ENSRNOG00000034177: 100%
Entrez Gene ID: 1946
Uniprot ID: P52803
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ |
| Gene ID - Mouse | ENSMUSG00000048915 |
| Gene ID - Rat | ENSRNOG00000034177 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen EFNA5 (ATL-APrEST91499) | |
| Datasheet | PrEST Antigen EFNA5 (ATL-APrEST91499) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EFNA5 (ATL-APrEST91499) at Atlas Antibodies |
| Documents & Links for PrEST Antigen EFNA5 (ATL-APrEST91499) | |
| Datasheet | PrEST Antigen EFNA5 (ATL-APrEST91499) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EFNA5 (ATL-APrEST91499) |