PrEST Antigen EFNA2 (ATL-APrEST94296)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94296-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Sequence: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG |
| Gene ID - Mouse | ENSMUSG00000003070 |
| Gene ID - Rat | ENSRNOG00000016203 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen EFNA2 (ATL-APrEST94296) | |
| Datasheet | PrEST Antigen EFNA2 (ATL-APrEST94296) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EFNA2 (ATL-APrEST94296) at Atlas Antibodies |
| Documents & Links for PrEST Antigen EFNA2 (ATL-APrEST94296) | |
| Datasheet | PrEST Antigen EFNA2 (ATL-APrEST94296) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EFNA2 (ATL-APrEST94296) |