PrEST Antigen E2F8 (ATL-APrEST92512)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92512-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: E2F8
Alternative Gene Name: FLJ23311
Sequence: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV
Interspecies mouse/rat: ENSMUSG00000046179: 80%, ENSRNOG00000022537: 80%
Entrez Gene ID: 79733
Uniprot ID: A0AVK6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV |
| Gene ID - Mouse | ENSMUSG00000046179 |
| Gene ID - Rat | ENSRNOG00000022537 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen E2F8 (ATL-APrEST92512) | |
| Datasheet | PrEST Antigen E2F8 (ATL-APrEST92512) Datasheet (External Link) |
| Vendor Page | PrEST Antigen E2F8 (ATL-APrEST92512) at Atlas Antibodies |
| Documents & Links for PrEST Antigen E2F8 (ATL-APrEST92512) | |
| Datasheet | PrEST Antigen E2F8 (ATL-APrEST92512) Datasheet (External Link) |
| Vendor Page | PrEST Antigen E2F8 (ATL-APrEST92512) |