PrEST Antigen DPT (ATL-APrEST92578)
Atlas Antibodies
- SKU:
- ATL-APrEST92578-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: DPT
Alternative Gene Name:
Sequence: GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
Interspecies mouse/rat: ENSMUSG00000026574: 91%, ENSRNOG00000002947: 94%
Entrez Gene ID: 1805
Uniprot ID: Q07507
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP |
Gene ID - Mouse | ENSMUSG00000026574 |
Gene ID - Rat | ENSRNOG00000002947 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen DPT (ATL-APrEST92578) | |
Datasheet | PrEST Antigen DPT (ATL-APrEST92578) Datasheet (External Link) |
Vendor Page | PrEST Antigen DPT (ATL-APrEST92578) at Atlas Antibodies |
Documents & Links for PrEST Antigen DPT (ATL-APrEST92578) | |
Datasheet | PrEST Antigen DPT (ATL-APrEST92578) Datasheet (External Link) |
Vendor Page | PrEST Antigen DPT (ATL-APrEST92578) |