PrEST Antigen DPH5 (ATL-APrEST93316)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93316-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: DPH5
Alternative Gene Name: CGI-30
Sequence: VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS
Interspecies mouse/rat: ENSMUSG00000033554: 94%, ENSRNOG00000013719: 95%
Entrez Gene ID: 51611
Uniprot ID: Q9H2P9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS |
| Gene ID - Mouse | ENSMUSG00000033554 |
| Gene ID - Rat | ENSRNOG00000013719 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen DPH5 (ATL-APrEST93316) | |
| Datasheet | PrEST Antigen DPH5 (ATL-APrEST93316) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DPH5 (ATL-APrEST93316) at Atlas Antibodies |
| Documents & Links for PrEST Antigen DPH5 (ATL-APrEST93316) | |
| Datasheet | PrEST Antigen DPH5 (ATL-APrEST93316) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DPH5 (ATL-APrEST93316) |