PrEST Antigen DHRS2 (ATL-APrEST88757)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88757-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: DHRS2
Alternative Gene Name: HEP27, SDR25C1
Sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Interspecies mouse/rat: ENSMUSG00000022209: 80%, ENSRNOG00000018177: 80%
Entrez Gene ID: 10202
Uniprot ID: Q13268
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL |
| Gene ID - Mouse | ENSMUSG00000022209 |
| Gene ID - Rat | ENSRNOG00000018177 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen DHRS2 (ATL-APrEST88757) | |
| Datasheet | PrEST Antigen DHRS2 (ATL-APrEST88757) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DHRS2 (ATL-APrEST88757) at Atlas Antibodies |
| Documents & Links for PrEST Antigen DHRS2 (ATL-APrEST88757) | |
| Datasheet | PrEST Antigen DHRS2 (ATL-APrEST88757) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DHRS2 (ATL-APrEST88757) |