PrEST Antigen COPB2 (ATL-APrEST91879)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91879-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: COPB2
Alternative Gene Name: beta'-COP, betaprime-COP
Sequence: GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Interspecies mouse/rat: ENSMUSG00000032458: 98%, ENSRNOG00000060723: 26%
Entrez Gene ID: 9276
Uniprot ID: P35606
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE |
| Gene ID - Mouse | ENSMUSG00000032458 |
| Gene ID - Rat | ENSRNOG00000060723 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen COPB2 (ATL-APrEST91879) | |
| Datasheet | PrEST Antigen COPB2 (ATL-APrEST91879) Datasheet (External Link) |
| Vendor Page | PrEST Antigen COPB2 (ATL-APrEST91879) at Atlas Antibodies |
| Documents & Links for PrEST Antigen COPB2 (ATL-APrEST91879) | |
| Datasheet | PrEST Antigen COPB2 (ATL-APrEST91879) Datasheet (External Link) |
| Vendor Page | PrEST Antigen COPB2 (ATL-APrEST91879) |