PrEST Antigen CHST5 (ATL-APrEST94976)
Atlas Antibodies
- SKU:
- ATL-APrEST94976-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: CHST5
Alternative Gene Name: FLJ22167, I-GLCNAC-6-ST
Sequence: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS
Interspecies mouse/rat: ENSMUSG00000031952: 81%, ENSRNOG00000021521: 79%
Entrez Gene ID: 23563
Uniprot ID: Q9GZS9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS |
Gene ID - Mouse | ENSMUSG00000031952 |
Gene ID - Rat | ENSRNOG00000021521 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen CHST5 (ATL-APrEST94976) | |
Datasheet | PrEST Antigen CHST5 (ATL-APrEST94976) Datasheet (External Link) |
Vendor Page | PrEST Antigen CHST5 (ATL-APrEST94976) at Atlas Antibodies |
Documents & Links for PrEST Antigen CHST5 (ATL-APrEST94976) | |
Datasheet | PrEST Antigen CHST5 (ATL-APrEST94976) Datasheet (External Link) |
Vendor Page | PrEST Antigen CHST5 (ATL-APrEST94976) |