PrEST Antigen C5orf38 (ATL-APrEST93158)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST93158-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: C5orf38
Alternative Gene Name: CEI, IRX2NB
Sequence: HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC
Interspecies mouse/rat: ENSMUSG00000025724: 27%, ENSRNOG00000011029: 27%
Entrez Gene ID: 153571
Uniprot ID: Q86SI9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC |
| Gene ID - Mouse | ENSMUSG00000025724 |
| Gene ID - Rat | ENSRNOG00000011029 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen C5orf38 (ATL-APrEST93158) | |
| Datasheet | PrEST Antigen C5orf38 (ATL-APrEST93158) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C5orf38 (ATL-APrEST93158) at Atlas Antibodies |
| Documents & Links for PrEST Antigen C5orf38 (ATL-APrEST93158) | |
| Datasheet | PrEST Antigen C5orf38 (ATL-APrEST93158) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C5orf38 (ATL-APrEST93158) |