PrEST Antigen C2orf73 (ATL-APrEST88545)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST88545-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: C2orf73
Alternative Gene Name: FLJ40298
Sequence: SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA
Interspecies mouse/rat: ENSMUSG00000040919: 74%, ENSRNOG00000006356: 72%
Entrez Gene ID: 129852
Uniprot ID: Q8N5S3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA |
| Gene ID - Mouse | ENSMUSG00000040919 |
| Gene ID - Rat | ENSRNOG00000006356 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen C2orf73 (ATL-APrEST88545) | |
| Datasheet | PrEST Antigen C2orf73 (ATL-APrEST88545) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C2orf73 (ATL-APrEST88545) at Atlas Antibodies |
| Documents & Links for PrEST Antigen C2orf73 (ATL-APrEST88545) | |
| Datasheet | PrEST Antigen C2orf73 (ATL-APrEST88545) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C2orf73 (ATL-APrEST88545) |