PrEST Antigen C11orf63 (ATL-APrEST94031)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST94031-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: C11orf63
Alternative Gene Name: FLJ23554
Sequence: YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI
Interspecies mouse/rat: ENSMUSG00000032023: 71%, ENSRNOG00000008138: 72%
Entrez Gene ID: 79864
Uniprot ID: Q6NUN7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI |
| Gene ID - Mouse | ENSMUSG00000032023 |
| Gene ID - Rat | ENSRNOG00000008138 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen C11orf63 (ATL-APrEST94031) | |
| Datasheet | PrEST Antigen C11orf63 (ATL-APrEST94031) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C11orf63 (ATL-APrEST94031) at Atlas Antibodies |
| Documents & Links for PrEST Antigen C11orf63 (ATL-APrEST94031) | |
| Datasheet | PrEST Antigen C11orf63 (ATL-APrEST94031) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C11orf63 (ATL-APrEST94031) |