PrEST Antigen BMP6 (ATL-APrEST92284)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92284-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: BMP6
Alternative Gene Name: VGR, VGR1
Sequence: FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Interspecies mouse/rat: ENSMUSG00000039004: 89%, ENSRNOG00000013717: 95%
Entrez Gene ID: 654
Uniprot ID: P22004
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY |
| Gene ID - Mouse | ENSMUSG00000039004 |
| Gene ID - Rat | ENSRNOG00000013717 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen BMP6 (ATL-APrEST92284) | |
| Datasheet | PrEST Antigen BMP6 (ATL-APrEST92284) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BMP6 (ATL-APrEST92284) at Atlas Antibodies |
| Documents & Links for PrEST Antigen BMP6 (ATL-APrEST92284) | |
| Datasheet | PrEST Antigen BMP6 (ATL-APrEST92284) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BMP6 (ATL-APrEST92284) |