PrEST Antigen ARIH2 (ATL-APrEST92882)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST92882-100
- Shipping:
- Calculated at Checkout
$369.00
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Sequence: DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV
Interspecies mouse/rat: ENSMUSG00000064145: 98%, ENSRNOG00000031827: 97%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV |
| Gene ID - Mouse | ENSMUSG00000064145 |
| Gene ID - Rat | ENSRNOG00000031827 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen ARIH2 (ATL-APrEST92882) | |
| Datasheet | PrEST Antigen ARIH2 (ATL-APrEST92882) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ARIH2 (ATL-APrEST92882) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ARIH2 (ATL-APrEST92882) | |
| Datasheet | PrEST Antigen ARIH2 (ATL-APrEST92882) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ARIH2 (ATL-APrEST92882) |