Anti ZZZ3 pAb (ATL-HPA066197)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066197-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZZZ3
Alternative Gene Name: ATAC1, DKFZP564I052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039068: 91%, ENSRNOG00000050321: 90%
Entrez Gene ID: 26009
Uniprot ID: Q8IYH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY |
| Gene Sequence | LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY |
| Gene ID - Mouse | ENSMUSG00000039068 |
| Gene ID - Rat | ENSRNOG00000050321 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197) | |
| Datasheet | Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link) |
| Vendor Page | Anti ZZZ3 pAb (ATL-HPA066197) at Atlas Antibodies |
| Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197) | |
| Datasheet | Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link) |
| Vendor Page | Anti ZZZ3 pAb (ATL-HPA066197) |