Anti ZYX pAb (ATL-HPA073497)

Atlas Antibodies

Catalog No.:
ATL-HPA073497-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: zyxin
Gene Name: ZYX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029860: 92%, ENSRNOG00000017354: 88%
Entrez Gene ID: 7791
Uniprot ID: Q15942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF
Gene Sequence PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF
Gene ID - Mouse ENSMUSG00000029860
Gene ID - Rat ENSRNOG00000017354
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZYX pAb (ATL-HPA073497)
Datasheet Anti ZYX pAb (ATL-HPA073497) Datasheet (External Link)
Vendor Page Anti ZYX pAb (ATL-HPA073497) at Atlas Antibodies

Documents & Links for Anti ZYX pAb (ATL-HPA073497)
Datasheet Anti ZYX pAb (ATL-HPA073497) Datasheet (External Link)
Vendor Page Anti ZYX pAb (ATL-HPA073497)