Anti ZYX pAb (ATL-HPA004835 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004835-25

Protein Description: zyxin
Gene Name: ZYX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029860: 84%, ENSRNOG00000017354: 85%
Entrez Gene ID: 7791
Uniprot ID: Q15942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
• Gene Sequence: PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
• Gene ID - Mouse: ENSMUSG00000029860
• Gene ID - Rat: ENSRNOG00000017354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZYX pAb (ATL-HPA004835 w/enhanced validation) – 7 Found

Harrington, Katherine M; Clevenger, Charles V. Identification of NEK3 Kinase Threonine 165 as a Novel Regulatory Phosphorylation Site That Modulates Focal Adhesion Remodeling Necessary for Breast Cancer Cell Migration. The Journal Of Biological Chemistry. 2016;291(41):21388-21406. 

Sporkova, Alexandra; Ghosh, Subhajit; Al-Hasani, Jaafar; Hecker, Markus. Lin11-Isl1-Mec3 Domain Proteins as Mechanotransducers in Endothelial and Vascular Smooth Muscle Cells. Frontiers In Physiology. 12( 34867475):769321. 

Fukumoto, Miki; Kurisu, Shusaku; Yamada, Tesshi; Takenawa, Tadaomi. α-Actinin-4 enhances colorectal cancer cell invasion by suppressing focal adhesion maturation. Plos One. 10(4):e0120616. 

Fukumoto, Miki; Ijuin, Takeshi; Takenawa, Tadaomi. PI(3,4)P(2) plays critical roles in the regulation of focal adhesion dynamics of MDA-MB-231 breast cancer cells. Cancer Science. 2017;108(5):941-951. 

Schell, Christoph; Sabass, Benedikt; Helmstaedter, Martin; Geist, Felix; Abed, Ahmed; Yasuda-Yamahara, Mako; Sigle, August; Maier, Jasmin I; Grahammer, Florian; Siegerist, Florian; Artelt, Nadine; Endlich, Nicole; Kerjaschki, Dontscho; Arnold, Hans-Henning; Dengjel, Jörn; Rogg, Manuel; Huber, Tobias B. ARP3 Controls the Podocyte Architecture at the Kidney Filtration Barrier. Developmental Cell. 2018;47(6):741-757.e8. 

Jain, Praachi B; Guerreiro, Patrícia S; Canato, Sara; Janody, Florence. The spectraplakin Dystonin antagonizes YAP activity and suppresses tumourigenesis. Scientific Reports. 2019;9(1):19843. 

van Gaal, Ronald C; Ippel, Bastiaan D; Spaans, Sergio; Komil, Muhabbat I; Dankers, Patricia Y W. Effectiveness of cell adhesive additives in different supramolecular polymers. Journal Of Polymer Science (2020). 2021;59(12):1253-1266.