Anti ZXDC pAb (ATL-HPA049593)

Atlas Antibodies

SKU:
ATL-HPA049593-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ZXD family zinc finger C
Gene Name: ZXDC
Alternative Gene Name: FLJ13861, MGC11349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034430: 55%, ENSRNOG00000025818: 52%
Entrez Gene ID: 79364
Uniprot ID: Q2QGD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLP
Gene Sequence KIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLP
Gene ID - Mouse ENSMUSG00000034430
Gene ID - Rat ENSRNOG00000025818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZXDC pAb (ATL-HPA049593)
Datasheet Anti ZXDC pAb (ATL-HPA049593) Datasheet (External Link)
Vendor Page Anti ZXDC pAb (ATL-HPA049593) at Atlas Antibodies

Documents & Links for Anti ZXDC pAb (ATL-HPA049593)
Datasheet Anti ZXDC pAb (ATL-HPA049593) Datasheet (External Link)
Vendor Page Anti ZXDC pAb (ATL-HPA049593)