Anti ZXDB pAb (ATL-HPA043789)

Atlas Antibodies

Catalog No.:
ATL-HPA043789-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, X-linked, duplicated B
Gene Name: ZXDB
Alternative Gene Name: ZNF905
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073062: 65%, ENSRNOG00000025818: 42%
Entrez Gene ID: 158586
Uniprot ID: P98169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVGPLGSLDSLAMKNSSPEPQAL
Gene Sequence DPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVGPLGSLDSLAMKNSSPEPQAL
Gene ID - Mouse ENSMUSG00000073062
Gene ID - Rat ENSRNOG00000025818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZXDB pAb (ATL-HPA043789)
Datasheet Anti ZXDB pAb (ATL-HPA043789) Datasheet (External Link)
Vendor Page Anti ZXDB pAb (ATL-HPA043789) at Atlas Antibodies

Documents & Links for Anti ZXDB pAb (ATL-HPA043789)
Datasheet Anti ZXDB pAb (ATL-HPA043789) Datasheet (External Link)
Vendor Page Anti ZXDB pAb (ATL-HPA043789)