Anti ZSWIM8 pAb (ATL-HPA041244)

Atlas Antibodies

Catalog No.: ATL-HPA041244-25

Protein Description: zinc finger, SWIM-type containing 8
Gene Name: ZSWIM8
Alternative Gene Name: 4832404P21Rik, KIAA0913
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021819: 100%, ENSRNOG00000056617: 100%
Entrez Gene ID: 23053
Uniprot ID: A7E2V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MELMFAEWEDGERFSFEDSDRFEEDSLCSFISEAESLCQNWRGWRKQS
• Gene Sequence: MELMFAEWEDGERFSFEDSDRFEEDSLCSFISEAESLCQNWRGWRKQS
• Gene ID - Mouse: ENSMUSG00000021819
• Gene ID - Rat: ENSRNOG00000056617
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.