Anti ZSWIM6 pAb (ATL-HPA035938)

Atlas Antibodies

Catalog No.: ATL-HPA035938-25

Protein Description: zinc finger, SWIM-type containing 6
Gene Name: ZSWIM6
Alternative Gene Name: KIAA1577
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032846: 84%, ENSRNOG00000014528: 86%
Entrez Gene ID: 57688
Uniprot ID: Q9HCJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPVGTLFSSLMEACRIDDENLSGFSDFTENMGQCKSLEYQHLPAHKFLEEGESYLTLAVEVAL
• Gene Sequence: DPVGTLFSSLMEACRIDDENLSGFSDFTENMGQCKSLEYQHLPAHKFLEEGESYLTLAVEVAL
• Gene ID - Mouse: ENSMUSG00000032846
• Gene ID - Rat: ENSRNOG00000014528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.