Anti ZRANB2 pAb (ATL-HPA053960)

Atlas Antibodies

Catalog No.:
ATL-HPA053960-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger, RAN-binding domain containing 2
Gene Name: ZRANB2
Alternative Gene Name: ZIS, ZIS1, ZIS2, ZNF265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028180: 100%, ENSRNOG00000009990: 100%
Entrez Gene ID: 9406
Uniprot ID: O95218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
Gene Sequence TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
Gene ID - Mouse ENSMUSG00000028180
Gene ID - Rat ENSRNOG00000009990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZRANB2 pAb (ATL-HPA053960)
Datasheet Anti ZRANB2 pAb (ATL-HPA053960) Datasheet (External Link)
Vendor Page Anti ZRANB2 pAb (ATL-HPA053960) at Atlas Antibodies

Documents & Links for Anti ZRANB2 pAb (ATL-HPA053960)
Datasheet Anti ZRANB2 pAb (ATL-HPA053960) Datasheet (External Link)
Vendor Page Anti ZRANB2 pAb (ATL-HPA053960)