Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA058673-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zona pellucida binding protein
Gene Name: ZPBP
Alternative Gene Name: SP38, ZPBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020193: 84%, ENSRNOG00000027801: 84%
Entrez Gene ID: 11055
Uniprot ID: Q9BS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG
Gene Sequence LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG
Gene ID - Mouse ENSMUSG00000020193
Gene ID - Rat ENSRNOG00000027801
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation)
Datasheet Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation)
Datasheet Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation)
Citations for Anti ZPBP pAb (ATL-HPA058673 w/enhanced validation) – 1 Found
Fagerberg, Linn; Hallström, Björn M; Oksvold, Per; Kampf, Caroline; Djureinovic, Dijana; Odeberg, Jacob; Habuka, Masato; Tahmasebpoor, Simin; Danielsson, Angelika; Edlund, Karolina; Asplund, Anna; Sjöstedt, Evelina; Lundberg, Emma; Szigyarto, Cristina Al-Khalili; Skogs, Marie; Takanen, Jenny Ottosson; Berling, Holger; Tegel, Hanna; Mulder, Jan; Nilsson, Peter; Schwenk, Jochen M; Lindskog, Cecilia; Danielsson, Frida; Mardinoglu, Adil; Sivertsson, Asa; von Feilitzen, Kalle; Forsberg, Mattias; Zwahlen, Martin; Olsson, IngMarie; Navani, Sanjay; Huss, Mikael; Nielsen, Jens; Ponten, Fredrik; Uhlén, Mathias. Analysis of the human tissue-specific expression by genome-wide integration of transcriptomics and antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2014;13(2):397-406.  PubMed