Anti ZP4 pAb (ATL-HPA008547)

Atlas Antibodies

Catalog No.:
ATL-HPA008547-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zona pellucida glycoprotein 4
Gene Name: ZP4
Alternative Gene Name: ZPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039342: 23%, ENSRNOG00000027506: 54%
Entrez Gene ID: 57829
Uniprot ID: Q12836
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
Gene Sequence FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
Gene ID - Mouse ENSMUSG00000039342
Gene ID - Rat ENSRNOG00000027506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZP4 pAb (ATL-HPA008547)
Datasheet Anti ZP4 pAb (ATL-HPA008547) Datasheet (External Link)
Vendor Page Anti ZP4 pAb (ATL-HPA008547) at Atlas Antibodies

Documents & Links for Anti ZP4 pAb (ATL-HPA008547)
Datasheet Anti ZP4 pAb (ATL-HPA008547) Datasheet (External Link)
Vendor Page Anti ZP4 pAb (ATL-HPA008547)