Anti-ZP3 pAb (ATL-HPA071198)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071198-100
- Shipping:
- Calculated at Checkout
        
            
        
        
        $596.00
    
         
                            | Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | CLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG | 
| Gene Sequence | CLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG | 
| Gene ID - Mouse | ENSMUSG00000004948 | 
| Gene ID - Rat | ENSRNOG00000001434 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti-ZP3 pAb (ATL-HPA071198) | |
| Vendor Page | Anti-ZP3 pAb (ATL-HPA071198) at Atlas Antibodies | 
| Documents & Links for Anti-ZP3 pAb (ATL-HPA071198) | |
| Vendor Page | Anti-ZP3 pAb (ATL-HPA071198) | 
 
         
                            