Anti ZP3 pAb (ATL-HPA054061)

Atlas Antibodies

Catalog No.:
ATL-HPA054061-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: zona pellucida glycoprotein 3 (sperm receptor)
Gene Name: ZP3
Alternative Gene Name: ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004948: 60%, ENSRNOG00000001434: 58%
Entrez Gene ID: 7784
Uniprot ID: P21754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD
Gene Sequence QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD
Gene ID - Mouse ENSMUSG00000004948
Gene ID - Rat ENSRNOG00000001434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZP3 pAb (ATL-HPA054061)
Datasheet Anti ZP3 pAb (ATL-HPA054061) Datasheet (External Link)
Vendor Page Anti ZP3 pAb (ATL-HPA054061) at Atlas Antibodies

Documents & Links for Anti ZP3 pAb (ATL-HPA054061)
Datasheet Anti ZP3 pAb (ATL-HPA054061) Datasheet (External Link)
Vendor Page Anti ZP3 pAb (ATL-HPA054061)