Anti ZNHIT2 pAb (ATL-HPA058066)

Atlas Antibodies

Catalog No.:
ATL-HPA058066-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger, HIT-type containing 2
Gene Name: ZNHIT2
Alternative Gene Name: C11orf5, FON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075227: 82%, ENSRNOG00000021794: 82%
Entrez Gene ID: 741
Uniprot ID: Q9UHR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL
Gene Sequence CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL
Gene ID - Mouse ENSMUSG00000075227
Gene ID - Rat ENSRNOG00000021794
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNHIT2 pAb (ATL-HPA058066)
Datasheet Anti ZNHIT2 pAb (ATL-HPA058066) Datasheet (External Link)
Vendor Page Anti ZNHIT2 pAb (ATL-HPA058066) at Atlas Antibodies

Documents & Links for Anti ZNHIT2 pAb (ATL-HPA058066)
Datasheet Anti ZNHIT2 pAb (ATL-HPA058066) Datasheet (External Link)
Vendor Page Anti ZNHIT2 pAb (ATL-HPA058066)