Anti ZNHIT2 pAb (ATL-HPA058066)

Atlas Antibodies

SKU: ATL-HPA058066-25

• 

Protein Description: zinc finger, HIT-type containing 2
Gene Name: ZNHIT2
Alternative Gene Name: C11orf5, FON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075227: 82%, ENSRNOG00000021794: 82%
Entrez Gene ID: 741
Uniprot ID: Q9UHR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL
• Gene Sequence: CTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEAL
• Gene ID - Mouse: ENSMUSG00000075227
• Gene ID - Rat: ENSRNOG00000021794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.