Anti ZNHIT1 pAb (ATL-HPA019043)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019043-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNHIT1
Alternative Gene Name: CG1I, H_DJ0747G18.14, ZNFN4A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059518: 97%, ENSRNOG00000001418: 97%
Entrez Gene ID: 10467
Uniprot ID: O43257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK |
| Gene Sequence | TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK |
| Gene ID - Mouse | ENSMUSG00000059518 |
| Gene ID - Rat | ENSRNOG00000001418 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNHIT1 pAb (ATL-HPA019043) | |
| Datasheet | Anti ZNHIT1 pAb (ATL-HPA019043) Datasheet (External Link) |
| Vendor Page | Anti ZNHIT1 pAb (ATL-HPA019043) at Atlas Antibodies |
| Documents & Links for Anti ZNHIT1 pAb (ATL-HPA019043) | |
| Datasheet | Anti ZNHIT1 pAb (ATL-HPA019043) Datasheet (External Link) |
| Vendor Page | Anti ZNHIT1 pAb (ATL-HPA019043) |
| Citations for Anti ZNHIT1 pAb (ATL-HPA019043) – 4 Found |
| Pünzeler, Sebastian; Link, Stephanie; Wagner, Gabriele; Keilhauer, Eva C; Kronbeck, Nina; Spitzer, Ramona Mm; Leidescher, Susanne; Markaki, Yolanda; Mentele, Edith; Regnard, Catherine; Schneider, Katrin; Takahashi, Daisuke; Kusakabe, Masayuki; Vardabasso, Chiara; Zink, Lisa M; Straub, Tobias; Bernstein, Emily; Harata, Masahiko; Leonhardt, Heinrich; Mann, Matthias; Rupp, Ralph Aw; Hake, Sandra B. Multivalent binding of PWWP2A to H2A.Z regulates mitosis and neural crest differentiation. The Embo Journal. 2017;36(15):2263-2279. PubMed |
| Zhao, Bing; Chen, Ying; Jiang, Ning; Yang, Li; Sun, Shenfei; Zhang, Yan; Wen, Zengqi; Ray, Lorraine; Liu, Han; Hou, Guoli; Lin, Xinhua. Znhit1 controls intestinal stem cell maintenance by regulating H2A.Z incorporation. Nature Communications. 2019;10(1):1071. PubMed |
| Procida, Tara; Friedrich, Tobias; Jack, Antonia P M; Peritore, Martina; Bönisch, Clemens; Eberl, H Christian; Daus, Nadine; Kletenkov, Konstantin; Nist, Andrea; Stiewe, Thorsten; Borggrefe, Tilman; Mann, Matthias; Bartkuhn, Marek; Hake, Sandra B. JAZF1, A Novel p400/TIP60/NuA4 Complex Member, Regulates H2A.Z Acetylation at Regulatory Regions. International Journal Of Molecular Sciences. 2021;22(2) PubMed |
| Wei, Wei; Tang, Xiaofang; Jiang, Ning; Ni, Chao; He, Hua; Sun, Shenfei; Yu, Meng; Yu, Chuyue; Qiu, Mengdi; Yan, Dong; Zhou, Zhaocai; Song, Yuanlin; Liu, Hanmin; Zhao, Bing; Lin, Xinhua. Chromatin remodeler Znhit1 controls bone morphogenetic protein signaling in embryonic lung tissue branching. The Journal Of Biological Chemistry. 2022;298(10):102490. PubMed |