Anti ZNF879 pAb (ATL-HPA068608)

Atlas Antibodies

SKU:
ATL-HPA068608-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 879
Gene Name: ZNF879
Alternative Gene Name: DKFZp686E2433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044296: 53%, ENSRNOG00000030517: 49%
Entrez Gene ID: 345462
Uniprot ID: B4DU55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKTYINEDKLEKQQGKKNRLFSKVLVTIK
Gene Sequence LEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKTYINEDKLEKQQGKKNRLFSKVLVTIK
Gene ID - Mouse ENSMUSG00000044296
Gene ID - Rat ENSRNOG00000030517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF879 pAb (ATL-HPA068608)
Datasheet Anti ZNF879 pAb (ATL-HPA068608) Datasheet (External Link)
Vendor Page Anti ZNF879 pAb (ATL-HPA068608) at Atlas Antibodies

Documents & Links for Anti ZNF879 pAb (ATL-HPA068608)
Datasheet Anti ZNF879 pAb (ATL-HPA068608) Datasheet (External Link)
Vendor Page Anti ZNF879 pAb (ATL-HPA068608)