Anti ZNF878 pAb (ATL-HPA052735)

Atlas Antibodies

Catalog No.:
ATL-HPA052735-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 878
Gene Name: ZNF878
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031907: 38%, ENSRNOG00000020087: 38%
Entrez Gene ID: 729747
Uniprot ID: C9JN71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR
Gene Sequence TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR
Gene ID - Mouse ENSMUSG00000031907
Gene ID - Rat ENSRNOG00000020087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF878 pAb (ATL-HPA052735)
Datasheet Anti ZNF878 pAb (ATL-HPA052735) Datasheet (External Link)
Vendor Page Anti ZNF878 pAb (ATL-HPA052735) at Atlas Antibodies

Documents & Links for Anti ZNF878 pAb (ATL-HPA052735)
Datasheet Anti ZNF878 pAb (ATL-HPA052735) Datasheet (External Link)
Vendor Page Anti ZNF878 pAb (ATL-HPA052735)