Anti ZNF865 pAb (ATL-HPA068079)

Atlas Antibodies

SKU:
ATL-HPA068079-25
  • Immunohistochemical staining of human esophagus shows nucleolar positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 865
Gene Name: ZNF865
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074405: 97%, ENSRNOG00000028628: 97%
Entrez Gene ID: 100507290
Uniprot ID: P0CJ78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLAHKAENL
Gene Sequence KGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLAHKAENL
Gene ID - Mouse ENSMUSG00000074405
Gene ID - Rat ENSRNOG00000028628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF865 pAb (ATL-HPA068079)
Datasheet Anti ZNF865 pAb (ATL-HPA068079) Datasheet (External Link)
Vendor Page Anti ZNF865 pAb (ATL-HPA068079) at Atlas Antibodies

Documents & Links for Anti ZNF865 pAb (ATL-HPA068079)
Datasheet Anti ZNF865 pAb (ATL-HPA068079) Datasheet (External Link)
Vendor Page Anti ZNF865 pAb (ATL-HPA068079)