Anti ZNF853 pAb (ATL-HPA067690)

Atlas Antibodies

Catalog No.: ATL-HPA067690-25

Protein Description: zinc finger protein 853
Gene Name: ZNF853
Alternative Gene Name: DKFZp434J1015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093910: 83%, ENSRNOG00000030579: 75%
Entrez Gene ID: 54753
Uniprot ID: P0CG23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ
• Gene Sequence: MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ
• Gene ID - Mouse: ENSMUSG00000093910
• Gene ID - Rat: ENSRNOG00000030579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.