Anti ZNF853 pAb (ATL-HPA067690)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067690-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF853
Alternative Gene Name: DKFZp434J1015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093910: 83%, ENSRNOG00000030579: 75%
Entrez Gene ID: 54753
Uniprot ID: P0CG23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ |
| Gene Sequence | MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ |
| Gene ID - Mouse | ENSMUSG00000093910 |
| Gene ID - Rat | ENSRNOG00000030579 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF853 pAb (ATL-HPA067690) | |
| Datasheet | Anti ZNF853 pAb (ATL-HPA067690) Datasheet (External Link) |
| Vendor Page | Anti ZNF853 pAb (ATL-HPA067690) at Atlas Antibodies |
| Documents & Links for Anti ZNF853 pAb (ATL-HPA067690) | |
| Datasheet | Anti ZNF853 pAb (ATL-HPA067690) Datasheet (External Link) |
| Vendor Page | Anti ZNF853 pAb (ATL-HPA067690) |