Anti ZNF853 pAb (ATL-HPA067690)

Atlas Antibodies

Catalog No.:
ATL-HPA067690-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 853
Gene Name: ZNF853
Alternative Gene Name: DKFZp434J1015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093910: 83%, ENSRNOG00000030579: 75%
Entrez Gene ID: 54753
Uniprot ID: P0CG23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ
Gene Sequence MLHQPTPRNRGLTARMEVGPATETFVLELRCLEDGGPGPDTLSGGSGGSESQ
Gene ID - Mouse ENSMUSG00000093910
Gene ID - Rat ENSRNOG00000030579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF853 pAb (ATL-HPA067690)
Datasheet Anti ZNF853 pAb (ATL-HPA067690) Datasheet (External Link)
Vendor Page Anti ZNF853 pAb (ATL-HPA067690) at Atlas Antibodies

Documents & Links for Anti ZNF853 pAb (ATL-HPA067690)
Datasheet Anti ZNF853 pAb (ATL-HPA067690) Datasheet (External Link)
Vendor Page Anti ZNF853 pAb (ATL-HPA067690)