Anti ZNF852 pAb (ATL-HPA049885)

Atlas Antibodies

Catalog No.:
ATL-HPA049885-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 852
Gene Name: ZNF852
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110277: 33%, ENSRNOG00000028504: 30%
Entrez Gene ID: 285346
Uniprot ID: Q6ZMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKD
Gene Sequence NLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKD
Gene ID - Mouse ENSMUSG00000110277
Gene ID - Rat ENSRNOG00000028504
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF852 pAb (ATL-HPA049885)
Datasheet Anti ZNF852 pAb (ATL-HPA049885) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA049885) at Atlas Antibodies

Documents & Links for Anti ZNF852 pAb (ATL-HPA049885)
Datasheet Anti ZNF852 pAb (ATL-HPA049885) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA049885)