Anti ZNF852 pAb (ATL-HPA048312)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048312-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF852
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 61%, ENSRNOG00000004104: 52%
Entrez Gene ID: 285346
Uniprot ID: Q6ZMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE |
| Gene Sequence | YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE |
| Gene ID - Mouse | ENSMUSG00000063488 |
| Gene ID - Rat | ENSRNOG00000004104 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF852 pAb (ATL-HPA048312) | |
| Datasheet | Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link) |
| Vendor Page | Anti ZNF852 pAb (ATL-HPA048312) at Atlas Antibodies |
| Documents & Links for Anti ZNF852 pAb (ATL-HPA048312) | |
| Datasheet | Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link) |
| Vendor Page | Anti ZNF852 pAb (ATL-HPA048312) |