Anti ZNF852 pAb (ATL-HPA048312)

Atlas Antibodies

Catalog No.:
ATL-HPA048312-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 852
Gene Name: ZNF852
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 61%, ENSRNOG00000004104: 52%
Entrez Gene ID: 285346
Uniprot ID: Q6ZMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
Gene Sequence YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
Gene ID - Mouse ENSMUSG00000063488
Gene ID - Rat ENSRNOG00000004104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF852 pAb (ATL-HPA048312)
Datasheet Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA048312) at Atlas Antibodies

Documents & Links for Anti ZNF852 pAb (ATL-HPA048312)
Datasheet Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA048312)