Anti ZNF829 pAb (ATL-HPA073073)

Atlas Antibodies

Catalog No.: ATL-HPA073073-25

Protein Description: zinc finger protein 829
Gene Name: ZNF829
Alternative Gene Name: DKFZp779O175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 44%, ENSRNOG00000020774: 47%
Entrez Gene ID: 374899
Uniprot ID: Q3KNS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLKKRHFSQVIITREDMSTFIQPTFLIPPQKTMSEEKPWECK
• Gene Sequence: LSLKKRHFSQVIITREDMSTFIQPTFLIPPQKTMSEEKPWECK
• Gene ID - Mouse: ENSMUSG00000099689
• Gene ID - Rat: ENSRNOG00000020774
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.