Anti ZNF790 pAb (ATL-HPA060288)

Atlas Antibodies

Catalog No.:
ATL-HPA060288-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 790
Gene Name: ZNF790
Alternative Gene Name: FLJ20350, MGC62100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078768: 44%, ENSRNOG00000048138: 44%
Entrez Gene ID: 388536
Uniprot ID: Q6PG37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSHESNFAQHQNIYTFEKSYEFKDFEKA
Gene Sequence CKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSHESNFAQHQNIYTFEKSYEFKDFEKA
Gene ID - Mouse ENSMUSG00000078768
Gene ID - Rat ENSRNOG00000048138
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF790 pAb (ATL-HPA060288)
Datasheet Anti ZNF790 pAb (ATL-HPA060288) Datasheet (External Link)
Vendor Page Anti ZNF790 pAb (ATL-HPA060288) at Atlas Antibodies

Documents & Links for Anti ZNF790 pAb (ATL-HPA060288)
Datasheet Anti ZNF790 pAb (ATL-HPA060288) Datasheet (External Link)
Vendor Page Anti ZNF790 pAb (ATL-HPA060288)