Anti ZNF790 pAb (ATL-HPA056134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056134-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF790
Alternative Gene Name: FLJ20350, MGC62100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050855: 44%, ENSRNOG00000051494: 44%
Entrez Gene ID: 388536
Uniprot ID: Q6PG37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRDETRGPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMRICKNHSLDCLC |
Gene Sequence | LRDETRGPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMRICKNHSLDCLC |
Gene ID - Mouse | ENSMUSG00000050855 |
Gene ID - Rat | ENSRNOG00000051494 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF790 pAb (ATL-HPA056134) | |
Datasheet | Anti ZNF790 pAb (ATL-HPA056134) Datasheet (External Link) |
Vendor Page | Anti ZNF790 pAb (ATL-HPA056134) at Atlas Antibodies |
Documents & Links for Anti ZNF790 pAb (ATL-HPA056134) | |
Datasheet | Anti ZNF790 pAb (ATL-HPA056134) Datasheet (External Link) |
Vendor Page | Anti ZNF790 pAb (ATL-HPA056134) |