Anti ZNF79 pAb (ATL-HPA028977 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028977-25

Protein Description: zinc finger protein 79
Gene Name: ZNF79
Alternative Gene Name: pT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051037: 27%, ENSRNOG00000006684: 27%
Entrez Gene ID: 7633
Uniprot ID: Q15937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAK
• Gene Sequence: KSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAK
• Gene ID - Mouse: ENSMUSG00000051037
• Gene ID - Rat: ENSRNOG00000006684
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.