Anti ZNF789 pAb (ATL-HPA050793)

Atlas Antibodies

Catalog No.:
ATL-HPA050793-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 789
Gene Name: ZNF789
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 27%, ENSRNOG00000060129: 29%
Entrez Gene ID: 285989
Uniprot ID: Q5FWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQFPKPEMICQLENWDEQWILDLPRTGNRKASGSACPGSEARHKMKKLTPKQKFSEDLESYKISVVMQESAEKLSEKLHKCKEFVDS
Gene Sequence FQFPKPEMICQLENWDEQWILDLPRTGNRKASGSACPGSEARHKMKKLTPKQKFSEDLESYKISVVMQESAEKLSEKLHKCKEFVDS
Gene ID - Mouse ENSMUSG00000029191
Gene ID - Rat ENSRNOG00000060129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF789 pAb (ATL-HPA050793)
Datasheet Anti ZNF789 pAb (ATL-HPA050793) Datasheet (External Link)
Vendor Page Anti ZNF789 pAb (ATL-HPA050793) at Atlas Antibodies

Documents & Links for Anti ZNF789 pAb (ATL-HPA050793)
Datasheet Anti ZNF789 pAb (ATL-HPA050793) Datasheet (External Link)
Vendor Page Anti ZNF789 pAb (ATL-HPA050793)