Anti ZNF778 pAb (ATL-HPA052057)

Atlas Antibodies

Catalog No.:
ATL-HPA052057-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 778
Gene Name: ZNF778
Alternative Gene Name: FLJ31875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092335: 33%, ENSRNOG00000028628: 34%
Entrez Gene ID: 197320
Uniprot ID: Q96MU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QACTRDRSLDYSSCGEVFLNQSYLQARAGSHNGEETWKWKPCGKALTHSMGCATPVEMHAVRNP
Gene Sequence QACTRDRSLDYSSCGEVFLNQSYLQARAGSHNGEETWKWKPCGKALTHSMGCATPVEMHAVRNP
Gene ID - Mouse ENSMUSG00000092335
Gene ID - Rat ENSRNOG00000028628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF778 pAb (ATL-HPA052057)
Datasheet Anti ZNF778 pAb (ATL-HPA052057) Datasheet (External Link)
Vendor Page Anti ZNF778 pAb (ATL-HPA052057) at Atlas Antibodies

Documents & Links for Anti ZNF778 pAb (ATL-HPA052057)
Datasheet Anti ZNF778 pAb (ATL-HPA052057) Datasheet (External Link)
Vendor Page Anti ZNF778 pAb (ATL-HPA052057)