Anti ZNF776 pAb (ATL-HPA068553)

Atlas Antibodies

Catalog No.:
ATL-HPA068553-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 776
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 27%, ENSRNOG00000015271: 28%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGE
Gene Sequence KQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGE
Gene ID - Mouse ENSMUSG00000050064
Gene ID - Rat ENSRNOG00000015271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF776 pAb (ATL-HPA068553)
Datasheet Anti ZNF776 pAb (ATL-HPA068553) Datasheet (External Link)
Vendor Page Anti ZNF776 pAb (ATL-HPA068553) at Atlas Antibodies

Documents & Links for Anti ZNF776 pAb (ATL-HPA068553)
Datasheet Anti ZNF776 pAb (ATL-HPA068553) Datasheet (External Link)
Vendor Page Anti ZNF776 pAb (ATL-HPA068553)