Anti ZNF771 pAb (ATL-HPA059398)

Atlas Antibodies

Catalog No.:
ATL-HPA059398-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 771
Gene Name: ZNF771
Alternative Gene Name: DSC43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054716: 92%, ENSRNOG00000043225: 90%
Entrez Gene ID: 51333
Uniprot ID: Q7L3S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP
Gene Sequence EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP
Gene ID - Mouse ENSMUSG00000054716
Gene ID - Rat ENSRNOG00000043225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF771 pAb (ATL-HPA059398)
Datasheet Anti ZNF771 pAb (ATL-HPA059398) Datasheet (External Link)
Vendor Page Anti ZNF771 pAb (ATL-HPA059398) at Atlas Antibodies

Documents & Links for Anti ZNF771 pAb (ATL-HPA059398)
Datasheet Anti ZNF771 pAb (ATL-HPA059398) Datasheet (External Link)
Vendor Page Anti ZNF771 pAb (ATL-HPA059398)