Anti ZNF771 pAb (ATL-HPA059398)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059398-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF771
Alternative Gene Name: DSC43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054716: 92%, ENSRNOG00000043225: 90%
Entrez Gene ID: 51333
Uniprot ID: Q7L3S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP |
Gene Sequence | EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP |
Gene ID - Mouse | ENSMUSG00000054716 |
Gene ID - Rat | ENSRNOG00000043225 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF771 pAb (ATL-HPA059398) | |
Datasheet | Anti ZNF771 pAb (ATL-HPA059398) Datasheet (External Link) |
Vendor Page | Anti ZNF771 pAb (ATL-HPA059398) at Atlas Antibodies |
Documents & Links for Anti ZNF771 pAb (ATL-HPA059398) | |
Datasheet | Anti ZNF771 pAb (ATL-HPA059398) Datasheet (External Link) |
Vendor Page | Anti ZNF771 pAb (ATL-HPA059398) |